Национальный цифровой ресурс Руконт - межотраслевая электронная библиотека (ЭБС) на базе технологии Контекстум (всего произведений: 543606)
Консорциум Контекстум Информационная технология сбора цифрового контента
Уважаемые СТУДЕНТЫ и СОТРУДНИКИ ВУЗов, использующие нашу ЭБС. Рекомендуем использовать новую версию сайта.
  Расширенный поиск
Результаты поиска

Нашлось результатов: 332 (2,20 сек)

Свободный доступ
Ограниченный доступ
Уточняется продление лицензии
1

Оценка клиентского капитала компании [Электронный ресурс] / Созонов // Вестник Московского университета. Серия 6. Экономика .— 2014 .— №6 .— С. 82-98 .— Режим доступа: https://rucont.ru/efd/377940

Автор: Созонов

Представлены результаты исследования по применению методов оценки клиентского капитала российской производственной В2В-компании.

следующих метрик: пожизненной ценности клиента (CLV), ценности клиента за прошлые периоды времени (PCV <...> evaluated on the basis of the following metrics: customer lifetime value (CLV), past customer value (PCV <...> Показатель PCV базируется на допущении, что доход от клиентов за предыдущие периоды времени является <...> Результаты оценки PCV по десяти крупнейшим клиентам и суммарная величина PCV по всем клиентам компании <...> Таблица 2 Расчет PCV исследуемой компании № клиента GC 2010, руб. GC 2011, руб. GC 2012, руб.

2

АНОМАЛЬНОЕ РАЗВИТИЕ СОСУДИСТОЙ СИСТЕМЫ У ЭМБРИОНОВ ДАНИО-РЕРИО С ПОНИЖЕННОЙ ЭКСПРЕССИЕЙ ГЕНА ПАНТОТЕНАТКИНАЗЫ 2 [Электронный ресурс] / Khatri [и др.] // Бюллетень экспериментальной биологии и медицины .— 2020 .— №7 .— С. 72-78 .— Режим доступа: https://rucont.ru/efd/724448

Автор: Khatri

Мутации в гене pank2, кодирующем пантотенаткиназу 2, вызывают ассоциированную с пантотенаткиназой нейродегенерацию — редкое заболевание, характеризующееся отложением депозитов железа в структуре бледного шара в головном мозге. В работе проводили микроинъекции новых pank2-специфичных морфолиновых олигонуклеотидов эмбрионам рыбы данио-рерио и детально исследовали развитие сосудистой системы. Развитие сосудов было сильно нарушено в голове, туловище и хвосте, где отмечалось значительное скопление крови, связанное с расширением задней кардинальной вены. Этот фенотип был специфичен для нокдауна данного гена, что подтверждалось анализом экспрессии белка р53 и инъекцией того же морфолинового олигонуклеотида эмбрионам, мутантным по гену pank2. Можно сделать вывод о том, что ген pank2 участвует в развитии сосудистой системы у эмбрионов данио-рерио. Исследование механизмов, лежащих в основе действия генов семейства pank, может иметь большое значение для понимания патологии нейродегенерации, ассоциированной с пантотенаткиназой

Для измерения диаметра задней кардинальной вены (posterior cardinal vein, PCV) эмбрионы каждого типа <...> В то время как у интактных эмбрионов спинная аорта (dorsal aorta, DA), PCV и ISVs уже были сформированы <...> Анализ чётко подтвердил наличие дефектов в сосудистых структурах, в частности дилатацию PCV. <...> по-видимому, вызывала у них улучшение развития сосудов, о чём свидетельствовало уменьшение диаметра PCV <...> MV — мезэнцефальная вена; PrA — прозэнцефальная артерия. г — изменения диаметра PCV (M±SD).

3

ВЛИЯНИЕ ЛУЧЕВОЙ ТЕРАПИИ НА РЕЗУЛЬТАТЫ КОМПЛЕКСНОГО ЛЕЧЕНИЯ ВНУТРИМОЗГОВЫХ СУПРАТЕНТОРИАЛЬНЫХ ИНФИЛЬТРАТИВНЫХ ГЛИОМ НИЗКОЙ СТЕПЕНИ ЗЛОКАЧЕСТВЕННОСТИ (GRADE II) У ВЗРОСЛЫХ [Электронный ресурс] / Милюков [и др.] // Вестник Российского университета дружбы народов. Серия: Медицина .— 2015 .— №4 .— С. 57-63 .— Режим доступа: https://rucont.ru/efd/408031

Автор: Милюков

Статья содержит результаты анализа значимых публикаций и исследовательских работ за последние 20 лет, посвященных значению лучевой терапии при лечении глиом низкой степени злокачественности. В данном литературном обзоре отражены роль и место лучевой терапии на сегодняшний день в лечении пациентов данной нозологической группы согласно последним результатам исследований и современным стандартам лечения, разработанными наиболее авторитетными научными учреждениями и международными исследовательскими группами.

При лечении пациентов с ГНСЗ (первичная опухоль) используются несколько схем химиотерапии, а именно: PCV <...> существующим стандартам (СОД 54Гр, доза за фракцию 1,8Гр), а в качестве химиотерапии была использована схема PCV <...> Practice changing mature results of RTOG study 9802: another positive PCV trial makes adjuvant chemotherapy <...> Practice changing mature results of RTOG study 9802: another positive PCV trial makes adjuvant chemotherapy

4

Бюллетень научных работ. Выпуск 12

[Б.и.]

Бюллетень научных работ. вып.12

Было высказано предложение о необходимости обозначить этот новый PCV , как цирковирус свиней-2 (PCV 2 <...> ), а исходному PCV -непатогенному контаминанту культуры клеток РК-15 дать обозначение PCV -1 (Allan C.M <...> Геномы PCV-1 и PCV-2 являются самыми мелкими среди вирусов животных (Lukert P.D., Allan G.М., 1999; Allan <...> Геномы PCV -1 и PCV -2 имеют приблизительно 70% гомологию. <...> Полный геном PCV-1 был клонирован и секвинирован. У генома PCV отсутствуют межгенные области.

Предпросмотр: Бюллетень научных работ. Выпуск 12.pdf (0,4 Мб)
5

ИЗМЕНЧИВОСТЬ ФЛУОРЕСЦЕНЦИИ ОТДЕЛЬНЫХ КЛЕТОК ВОДОРОСЛИ CONTICRIBRA WEISSFLOGII ПРИ ОСМОТИЧЕСКОМ СТРЕССЕ [Электронный ресурс] / Курочкина [и др.] // Вода: химия и экология .— 2013 .— №2 .— С. 73-78 .— Режим доступа: https://rucont.ru/efd/536367

Автор: Курочкина

у диатомовой водоросли conticribra weissflogii, акклимированной к солености 17,5 ‰ оценивали относительную переменную флуоресценции отдельных клеток (fvи/fmи) после пересева на среды с соленостью 8,8 ‰ (гипоосмотические условия), 35 ‰ (гиперосмотические условия) и 17,5 ‰ (контроль). Как в гипо-, так и в гиперосмотических условиях в первые 2–4 ч возрастала доля нежизнеспособных клеток, доля клеток с максимальной fvи/fmи снижалась, вариабельность клеток по fvи/fmи была наибольшей. через сутки доля нежизнеспособных клеток снизилась, доля клеток с максимальной fvи/fmи увеличилась, вариабельность клеток по fvи/fmи снизилась.

В течение суток степень варьирования Fv и/Fm и в гипоосмотических условиях достоверно снизилась (Pcv <...> Достоверность различий CV (Pcv) оценивали по критерию Флайгнера-Киллена (Fligner-Killeen Test), а достоверность <...> коэффициент вариации Fv и/ Fm и (CV, %), достоверность различий средних значений Fv и/Fm и (Рср) и CV (Pcv <...> эксперимент II) Время, ч Эксперимент I Эксперимент II Fv и/Fm и CV Fv и/Fm и CV 8,8 ‰ 17,5 ‰ Рср 8,8 ‰ 17,5 ‰ Pcv <...> 35 ‰ 17,5 ‰ Рср 35 ‰ 17,5 ‰ Pcv 2 0,58 0,60 0,71 36 27 0,11 0,47 0,52 0,02 39 31 0,37 4 0,57 0,60 0,09

6

№6 [Вестник Московского университета. Серия 6. Экономика, 2014]

Основан в 1946г. Журнал является периодическим научным изданием. Его основная задача – отражение фундаментальных и практически значимых научных и учебно-методических достижений профессоров, преподавателей, научных сотрудников, докторантов, стажеров и аспирантов экономического факультета МГУ имени М.В. Ломоносова, а также работников вузов и научных организаций России и стран СНГ (Республика Беларусь, Таджикистан, Казахстан, Узбекистан, Украина и др.), руководящих работников и ведущих специалистов федеральных органов власти.

Показатель PCV базируется на допущении, что доход от клиентов за предыдущие периоды времени является <...> PCV определяет кумулятивный вклад потребителя в капитал компании до текущего периода времени [Kumar, <...> Однако на практике при оценке по метрике PCV зачастую для осуществления расчетов берут показатели за <...> Результаты оценки PCV по десяти крупнейшим клиентам и суммарная величина PCV по всем клиентам компании <...> Таблица 2 Расчет PCV исследуемой компании № клиента GC 2010, руб. GC 2011, руб. GC 2012, руб.

Предпросмотр: Вестник Московского университета. Серия 6. Экономика №6 2014.pdf (0,7 Мб)
7

Анестезиологическое обеспечение технологий двухэтапных комбинированных вмешательств в хирургии посттравматических деформаций позвоночника [Электронный ресурс] / Лукьянов [и др.] // Хирургия позвоночника .— 2015 .— №1 .— С. 86-93 .— Режим доступа: https://rucont.ru/efd/423300

Автор: Лукьянов

Цель исследования: Анализ влияния последовательности выполнения вентрального и дорсального спондилодезов позвоночника, выполняемых в условиях комбинированной анестезии в одну хирургическую сессию, на состояние газообмена и гемодинамический статус оперируемых. Материал и методы. Проанализированы показатели газообмена и гемодинамического статуса у 125 пациентов с постравматическими деформациями позвоночника, оперированных по технологии двухэтапных комбинированных вмешательств в одну хирургическую сессию. С учетом последовательности выполнения спондилодеза выделены две группы наблюдений: I – 60 больных (дорсальный предшествует вентральному), II – 65 больных (вентральный предшествует дорсальному). Результаты. Основными факторами, влияющими на степень выраженности отклонений в показателях гемодинамики и газообмена, являются особенности этапа, связанные с открытым пневмотораксом, механическим сдавлением легкого и гиперэкстензией позвоночника, что требует корректировки параметров ИВЛ и темпа инфузионного обеспечения. Наиболее статистически значимые изменения анализируемых показателей зарегистрированы у пациентов I группы. Заключение. Более физиологичными для оперируемых являются хирургические воздействия, выполняемые на вентральных отделах позвоночника в качестве первого этапа хирургической операции.

Далее ИВЛ продолжали в режиме PCV (Pressure Control Ventilation) по полузакрытому контуру с потоком свежего <...> Результаты В обеих группах после индукции в анестезию и переводе ИВЛ в режим PCV по полузакрытому контуру <...> легкого и гиперэкстензия позвоночника (рис. 1) уменьшали газообменную поверхность легких, что в режиме PCV

8

№3 [Практическая онкология, 2013]

В журнале освещаются вопросы эпидемиологии, этиологии, диагностики, профилактики и лечения некоторых наиболее часто встречающихся опухолей. Авторы - прогрессивные ученые-онкологи, развивающие современную онкологическую науку и имеющие серьезный практический опыт в лечении онкологический заболеваний. Каждый выпуск журнала освещает конкретно определенную тему, по которой публикуются как специализированные статьи и лекции, клинические наблюдения и обзоры литературы в области научных и практических исследований по клинической и экспериментальной онкологии так и материалы оригинальных работ,содержащих результаты диссертаций на соискание ученой степени доктора и кандидата медицинских наук

И с тех пор схема PCV стала стандартом в терапии этой группы пациентов после ЛТ. <...> преимущества схемы PCV по сравнению с BCNU [57] M. <...> – 49,0 мес), и общей выживае� мости (ЛТ – 59,3 мес; ЛТ+PCV – не достигнута). <...> Wick с соавторами (2009) – при терапии темозоломидом и PCV, M. <...> При те� рапии по схеме PCV выживаемость составила от 16 до 108 месяцев [23].

Предпросмотр: Практическая онкология №3 2013.pdf (0,2 Мб)
9

МОЛЕКУЛЯРНО‑ГЕНЕТИЧЕСКИЙ МОНИТОРИНГ СПЕЦИФИЧЕСКИХ ВОЗБУДИТЕЛЕЙ РЕПРОДУКТИВНЫХ НАРУШЕНИЙ У СВИНЕЙ [Электронный ресурс] / О.А. Манжурина [и др.] // Ветеринарный Фармакологический Вестник .— 2019 .— №3 .— Режим доступа: https://rucont.ru/efd/702687

Автор: Манжурина О. А.

В статье представлены данные по инфицированности спермы хряков, абортплодов, влагалищных смывов свиноматок из хозяйств Воронежской и Белгородской областей за период с 2016 по 2018 год. Установлена циркуляция среди свиней 8 возбудителей инфекций (микоплазмы, хламидии, сальмонеллы, листерии, лептоспиры, вирусы РРСС, ПВИС, ЦВИ), способных вызвать репродуктивные нарушения у свиней.

circulation of 8 pathogens (mycoplasmas, chlamydiae, salmonellae, listeriae, leptospirae, PRRS, PPV, PCV <...> PCV-2, listeriae, leptospirae, campylobacters were not isolated from boar semen during the experiment <...> 2 / 4.4 9 Campylobacters 0.0 0.0 0.0 0.0 During the analyzed period, the associations of PRRS, PPV, PCV <...> in 335 (46.6 %) cases, including in association with PRRS virus — in 8 (2.3 %), PPV — in 5 (1.4 %), PCV <...> The number of positive samples /% 2016y n = 198 2017y n = 202 2018г n = 194 Total number n = 594 1 PCV

10

ЭПИЗООТОЛОГИЧЕСКИЙ МОНИТОРИНГ ЦИРКОВИРУСНОЙ, ПАРВОВИРУСНОЙ ИНФЕКЦИЙ И РЕПРОДУКТИВНО-РЕСПИРАТОРНОГО СИНДРОМА СВИНЕЙ НА ТЕРРИТОРИИ УДМУРТСКОЙ РЕСПУБЛИКИ [Электронный ресурс] / Крысенко, Трошин, Капачинских // Вестник Ижевской государственной сельскохозяйственной академии .— 2015 .— №2 .— С. 23-26 .— Режим доступа: https://rucont.ru/efd/392279

Автор: Крысенко

Цирковирусная инфекция свиней (ЦВИС), парвовирусная инфекция свиней (ПВИС), репродуктивнореспираторный синдром свиней (РРСС) в настоящее время, по данным производственного серологического мониторинга в разных странах мира, в том числе в Российской Федерации, весьма широко распространены на свиноводческих предприятиях промышленного типа. Целью исследования явилось проведение серологического мониторинга на ЦВИС, ПВИС и РРСС на территории Удмуртской Республики, с учетом определенного возрастного фактора, когда начинают проявляться и получают развитие эти заболевания. Инфицированность поголовья поросят в возрасте от 28 до 120 дней установлена на уровне более 50%, что свидетельствует о широкой циркуляции вируса в исследуемой возрастной категории животных. Выявлено, что уровень серопозитивности на ЦВИС составляет 49,1%, РРСС – на уровне 47,5%, ПВИС колеблется в пределах 36,3%. При исследовании различных видов патологических материалов в полимеразно-цепной реакции выявлены вирусные антигены на ЦВИС и РРСС, что свидетельствует об ассоциированной форме течения заболевания у поросят в группе доращивания.

REPRODUCTIVE AND RESPIRATORY SYNDROME OF PIGS IN THE UDMURT REPUBLIC Porcine circovirus infection (PCV <...> The aim of this study was to conduct serological monitoring for PCV, PVIS and PRRS in the Udmurt Republic <...> It was found that the level of PCV seropositivity was 49.1%, PRRS level 47.5%, PVIS varied about 36.3% <...> different types of pathological materials in the polymerase chain reaction (PCR) viral antigens on PCV <...> Key words: monitoring; seropositivity; PCV; PVIS; PRRS.

11

Анестезиологическое обеспечение лапароскопических хирургических вмешательств [Электронный ресурс] / Жудро, Илюкевич // Экстренная медицина .— 2016 .— №1 .— С. 8-16 .— Режим доступа: https://rucont.ru/efd/473985

Автор: Жудро

Обзор литературы посвящен анестезиологическому обеспечению лапароскопий. Дано описание особенностей физиологии органов и систем при лапароскопических операциях. Обсуждаются вопросы подготовки перед операцией, премедикации, мониторинга, выбора вида анестезии, послеоперационного ведения пациента

Выбор режима вентиляции (с контролем по объему – IPPV или с контролем по давлению – PCV), по сообщениям <...> В случае применения режима PCV поток изменяется, давление в дыхательных путях не изменяется, а объем <...> Выбор режима PCV обеспечивает более высокий комплаенс, более низкое пиковое давление, давление плато,

12

CORROSION PROTECTION OF STEEL STRUCTURES BY PROTECTIVE PAINT SYSTEMS ACCORDING TO EU STANDARDS [Электронный ресурс] / J. Kobus // Проблемы машиностроения и автоматизации .— 2007 .— №4 .— С. 125-131 .— Режим доступа: https://rucont.ru/efd/424509

Автор: Kobus Joanna

European standards relating to corrosion protection for steel structures by protective paint systems in atmospheric conditions, in soil and water were presented. Standards contain basic as complete as possible data necessary to assure effective corrosion protection for owners of structure, planners, consultants, companies carrying out protection work , inspectors and manufacturers of coating materials. Scope of this data covers: classification of environment corrosivity, design considerations, surface preparation before painting, selection of protective paint systems, laboratory test methods, execution and supervision of paint work and development of specifications for new work and maintenance.

coats Thickness μm Number of coats Thickness μm C2 C3 C4 C5I C5M L M H L M H L M H L M H L M H GS-1 PCV <...> PCV 1 80 1 80 GS-2 1 40 1 80 2 120 GS-3 1 80 1 80 2 160 GS-4 1 80 2 160 3 240 GS-5 Acryl Acryl 1 80

13

Инновационная вакцина против пневмококковой инфекции в профилактике обострений хронических заболеваний у взрослых [Электронный ресурс] / Костинов, Чучалин, Коровкина // Здравоохранение Российской Федерации .— 2015 .— №5 .— С. 51-55 .— Режим доступа: https://rucont.ru/efd/393788

Автор: Костинов

Пневмококковая инфекция занимает одну из лидирующих позиций в структуре заболеваний, приводящих к летальному исходу вне зависимости от возраста, особенно среди детей первого года жизни и в возрастной группе старше 55 лет. Согласно новой стратегии ВОЗ вакцинация против данной инфекции должна быть включена в национальные календари прививок у вышеуказанных категорий лиц. Давно существующая полисахаридная пневмококковая вакцина показала свою эффективность у детей старше двух лет и взрослых, однако клинический и иммунологический эффект характеризовался гипореспонсивностью. С появлением конъюгированных пневмококковых вакцин стала реальной профилактика указанной инфекции у детей раннего возраста, что позволило включить их в национальные календари прививок 113 стран. В последние годы у взрослых также установлена эффективность 13-валентной конъюгированной пневмококковой вакцины в профилактике неинвазивной (45%) и инвазивной (75%) пневмококковой инфекции, вызванной вакцинными серотипами. Результаты отечественных исследователей по вакцинации той же вакциной пациентов с хронической бронхолегочной патологией свидетельствуют о снижении количества обострений, заболеваемости пневмониями и госпитализаций в 5—11 раз, улучшении при этом качества жизни данной категории пациентов и уменьшении затрат на оказание медицинской помощи. Все это указывает на необходимость внедрения иммунизации конъюгированной пневмококковой вакциной в стандарт лечебно-профилактических мероприятий.

PCV 13 EPAR: CHMP variation assessment report 2011; 12. <...> PCV 13 EPAR: CHMP variation assessment report 2011; 12.

14

№3 [Холодильная техника, 2012]

Единственный в России и странах СНГ научно-технический и информационно-аналитический ежемесячный журнал о научно-технических разработках по всем направлениям холодильной, криогенной техники и технологии, по кондиционированию и вентиляции, автоматизации и управлению, рефтранспорту, процессам и аппаратам пищевых производств, рабочим веществам, проблемам экологии и энергосбережения. Более 100 лет журнал является первоисточником информации по фундаментальным и прикладным работам ведущих отечественных и зарубежных ученых, а также изданием для публикации результатов диссертаций на соискание ученой степени кандидата и доктора наук. Журнал входит в Перечень ВАК по специальностям 05.04.03 и 05.18.04, международную реферативную базу данных Agris, зарегистрирован в Российском индексе научного цитирования (РИНЦ).

production by means of a one screw compressor HEAT EXCHANGE EQUIPMENT/ UP-TO-DATE SOLUTIONS LUVATA PCV <...> Конденсаторы серии PCV малой тепловой мощ� ности дополняют серии PKE и PVE отсеками для компрессоров <...> Это объясняет причину, по которой конденсаторы PCV особенно ценятся разными организациями (монтажные, <...> Все технические и эксплуатационные характери� стики конденсаторов PCV представлены в новом каталоге « <...> Помимо конденсаторов PCV, в каталог был включен ряд новинок, а также для облегчения просмотра в него

Предпросмотр: Холодильная техника №3 2012.pdf (1,1 Мб)
15

ДАЛЬНИЙ ПАРАМЕТРИЧЕСКИЙ ПРИЕМ И ПЕРЕДАЧА ИНФОРМАЦИОННЫХ ВОЛН В ПРОСВЕТНЫХ ГИДРОАКУСТИЧЕСКИХ СИСТЕМАХ КОНТРОЛЯ МОРСКИХ АКВАТОРИЙ [Электронный ресурс] / Малашенко [и др.] // Датчики и системы. Sensors & Systems .— 2013 .— №11 (174) .— С. 58-63 .— Режим доступа: https://rucont.ru/efd/598968

Автор: Малашенко

Обосновано нелинейное взаимодействие и параметрическое преобразование акустических просветных волн с измеряемыми или передаваемыми информационными волнами различной физической природы. Рассмотрены практические пути решения задачи дальнего параметрического приема и передачи информационных волн в просветных системах мониторинга и контроля морских акваторий, формируемых с использованием измерительных радиогидроакустических средств морского приборостроения

объеìа ëокаöии; γ — коэффиöиент неëинейности ìорской среäы; рn — äавëение просветноãо γ 1+( )ωnωc pn pcV <...> 4ρ0 c0( ) 3 R 2 ----------------------------------------------γ 1+( )ωc pcV 2ρ0 c0( ) 3 R 2 --------

16

ПОЛУЧЕНИЕ РЕКОМБИНАНТНЫХ ОСМОУСТОЙЧИВЫХ КЛУБЕНЬКОВЫХ БАКТЕРИЙ И ИХ ВЛИЯНИЕ НА СТРУКТУРУ УРОЖАЯ, ВОДОПОТРЕБЛЕНИЕ И АНДРОГЕНЕЗ РАСТЕНИЙ СОИ АВТОРЕФЕРАТ ДИС. ... КАНДИДАТА СЕЛЬСКОХОЗЯЙСТВЕННЫХ НАУК

Автор: СОЛОВЬЕВ ВЛАДИМИР ПЕТРОВИЧ
М.: МОСКОВСКАЯ СЕЛЬСКОХОЗЯЙСТВЕННАЯ АКАДЕМИЯ ИМЕНИ К. А. ТИМИРЯЗЕВА

Цель исследований. Цель исследований - изучение влияния ризобиальных бактерий-суперпродуцентов пролина на эффективность симбиоза с растениями сои.

.); pCV 16 (Таняшин В.И. и др.): pVA 12-2 (Денисова Т.е. <...> пидиллину (Ыа) из плаэмиды pCV 16 (см рис 1) Ген Ы а вырезали с помощью рестриктазы Eco RI и лигпровали

Предпросмотр: ПОЛУЧЕНИЕ РЕКОМБИНАНТНЫХ ОСМОУСТОЙЧИВЫХ КЛУБЕНЬКОВЫХ БАКТЕРИЙ И ИХ ВЛИЯНИЕ НА СТРУКТУРУ УРОЖАЯ, ВОДОПОТРЕБЛЕНИЕ И АНДРОГЕНЕЗ РАСТЕНИЙ СОИ.pdf (0,0 Мб)
17

НАЦИОНАЛЬНОЕ ЭПИДЕМИОЛОГИЧЕСКОЕ ИССЛЕДОВАНИЕ РУВЕНТ: ПРИМЕНЕНИЕ ИСКУССТВЕННОЙ ВЕНТИЛЯЦИИ ЛЕГКИХ В ОТДЕЛЕНИЯХ РЕАНИМАЦИИ И ИНТЕНСИВНОЙ ТЕРАПИИ У ДЕТЕЙ [Электронный ресурс] / Суворов [и др.] // Анестезиология и реаниматология .— 2015 .— №2 .— С. 30-35 .— Режим доступа: https://rucont.ru/efd/379580

Автор: Суворов

Цель исследования. Определение реальной ситуации режимов и параметров пролонгированной респираторной поддержки в России у детей. Материал и методы. В исследование включены все пациенты ОРИТ в возрасте от 0 до 15 лет с длительностью ИВЛ более 12 ч в период с 7 по 11 февраля (5 рабочих дней) 2011 г. – 104 ребенка из 28 ОРИТ Российской Федерации и 1 ОРИТ Украины (всего 29 центров). Значительную часть пациентов (68%) составили новорожденные и грудные дети. Рекрутирование центров и сбор данных осуществляли при помощи он-лайн-форм.

поддержки Режим* Частота у детей, % Частота общая, % SIMV+PS 41,3 45,1 A/C 28,8 20,1 BIPAP 12,5 12,6 PCV <...> Mandatory Ventilation; CPAP – Constant Positive Airway Pressure; BIPAP – Biphasic Positive Airway Pressure; PCV

18

NEW DIAGNOSTIC CRITERIA FOR COMMON VARIABLE IMMUNE DEFICIENCY (CVID), WHICH MAY ASSIST WITH DECISIONS TO TREAT WITH INTRAVENOUS OR SUBCUTANEOUS IMMUNOGLOBULIN [Электронный ресурс] / Ameratunga [и др.] // Вопросы гематологии/онкологии и иммунопатологии в педиатрии .— 2014 .— №4 .— С. 21-35 .— Режим доступа: https://rucont.ru/efd/611459

Автор: Ameratunga

Common variable immune deficiency (CVID) is the most frequent symptomatic primary immune deficiency in adults. The standard of care is intravenous immunoglobulin (IVIG) or subcutaneous immunoglobulin (scIG) therapy. The cause of CVID is currently unknown, and there is no universally accepted definition of CVID. This creates problems in determining which patients will benefit from IVIG/scIG treatment. In this paper, we review the difficulties with the commonly used European Society of Immune Deficiencies (ESID) and the Pan American Group for Immunodeficiency (PAGID) definition of CVID. We propose new criteria for the diagnosis of CVID, which are based on recent scientific discoveries. Improved diagnostic precision will assist with treatment decisions including IVIG/scIG replacement. We suggest that asymptomatic patients with mild hypogammaglobulinaemia are termed hypogammaglobulinaemia of uncertain significance (HGUS). These patients require long-term follow-up, as some will evolve into CVID.

vaccine, pneumococcal polysaccharide vaccine (PPV), Pneumovax® and pneumococcal conjugated vaccines (PCV <...> PCV tests responses to proteins, while PPV tests responses to carbohydrate antigens. <...> используются два типа пневмококковых вакцин – полисахаридная (PPV, Пневмовакс®) и конъюгированная (PCV <...> С помощью PCV тестируют ответ на протеины, с помощью РРV – ответ на углеводные антигены.

19

Применение уровней эксплуатационной пригодности и безопасности [Электронный ресурс] / Khalil, Cheddie // Нефтегазовые технологии .— 2010 .— №4 .— С. 95-97 .— Режим доступа: https://rucont.ru/efd/262220

Автор: Khalil
М.: ПРОМЕДИА

Уровни эксплуатационной пригодности и безопасности распространяются от инструментальной функции безопасности к установке того, как эти функции должны выполняться, управляться, обслуживаться и корректироваться. Они являются важным параметром, характеризующим жизненный цикл. Были заданы два режима операции, включая режим работы минимального потребления и режим работы максимального потребления или постоянного.

темпы выхода Закупорка нагнетательного потока трубопровода или системы 0,01 1 0,03 3,00Е-04 Закрывается PCV

20

Влияние флуктуаций состава на излучательную рекомбинацию в узкозонных полупроводниковых твердых растворах [Электронный ресурс] / Шиляев [и др.] // Журнал технической физики .— 2017 .— №3 .— С. 101-108 .— Режим доступа: https://rucont.ru/efd/591669

Автор: Шиляев

Экспериментально исследована фотолюминесценция эпитаксиальных структур на основе узкозонных твердых растворов CdHgTe и установлено наличие в структурах масштабных флуктуаций состава, локализующих носители заряда. Предложена модель, описывающая влияние флуктуаций на скорость излучательной рекомбинации, форму спектров люминесценции и положение их пика. Модель описывает транспорт и рекомбинацию носителей в условиях сильной неоднородности состава твердого раствора и показывает, как локализация носителей проявляется в особенностях спектров люминесценции

√ ωq √ V e−iqr, (8) где eν — один из двух возможных ортов поляризации, nω — показатель преломления, pcv <...> �qδ ( �cq nω − ε ) = ∫ V d3q (2π)3 δ ( �cq nω − ε ) = V n3ωε 2 2π2�3c3 (9) получаем W1→2 = 4e2nωε12|Pcv <...> |2 �2m20c 3 e− (r1−r2)2 2a2 − (k1−k2) 2a2 2 . (10) Здесь ε12 = Eg + εe(k1) + εh(k2), а |Pcv | = |eνpcv

21

№3 [Вопросы гематологии/онкологии и иммунопатологии в педиатрии, 2008]

Научно-практический журнал Международной организации Consensus in Pediatrics. Журнал выпускается с 2002 г. и предназначен для детских онкологов и гематологов, педиатров, научных работников. Журнал входит в Международную реферативную базу Scopus и в Перечень ведущих научных журналов и изданий ВАК, в которых должны быть опубликованы основные результаты диссертаций на соискание ученой степени кандидата и доктора наук. Журнал зарегистрирован в Ulrich's International Periodical Directory, РИНЦ. Журнал публикует оригинальные исследования, обзоры литературы, лекции, методические рекомендации, клинические наблюдения, официальные документы органов управления здравоохранением. Тематика публикаций: - диагностика, особенности течения, лекарственная терапия опухолевых заболеваний, болезней крови, иммунодефицитных и иммунопатологических состояний в детском возрасте; - большое внимание уделяется вопросам фармакотерапии с применением химиотерапевтических средств, рекомбинантных интерферонов, интерлейкинов и колониестимулирующих факторов, моноклональных противоопухолевых препаратов, иммуноглобулинов и факторов свертывания крови.

MCV4 инфекция (MCV4) внутри прерывистой линии – MCV4 MCV4 для отдельных групп Пневмококковая инфекция (PCV <...> , PPV) PCV PCV PCV PCV PPV PPV Грипп Грипп (ежегодно) Грипп (ежегодно) Гепатит А (Hep-A) Hep-A (двукратно <...> менингококковая конъюгированная вакцина Менцевакс, включающая полисахариды А, С, Y, W-135 групп менингококков; PCV <...> 21,78 Hep-B 3 27 9 72,6 24,2 DT 1 7,91 7,91 7,91 7,91 Против ветряной оспы 1 44,08 44,08 58,11 58,11 PCV7 <...> OPV – живая пероральная полиомиелитная вакцина; DTP – коклюшно-дифтерийно-столбнячная вакцина; PCV7 –

Предпросмотр: Вопросы гематологиионкологии и иммунопатологии в педиатрии №3 2008.pdf (0,1 Мб)
22

№1 [Педиатрическая фармакология, 2014]

В журнале «Педиатрическая фармакология» можно ознакомиться с клиническими рекомендациями, основанными на принципах доказательной медицины, и особенностями применения лекарственных и вакцинных средств у детей. Получить исчерпывающую информацию о воздействии лекарственных средств на плод, о проводимых в нашей стране фармако-экономических исследованиях, а также о наиболее нерешенной проблеме детской фармакологии – проведении клинических исследований, их правовых и этических аспектах. Кроме того, авторам, членам редакционного совета, ведущим рубрики, читателям предоставляется возможность принять участие в научной дискуссии на страницах журнала по опубликованным материалам, а также предложить свою тему для обсуждения, представив результаты собственного исследования, не согласующиеся с общепринятыми данными. Журнал предназначен практикующим педиатрам, детским врачам, специализирующимся в различных областях педиатрии, а также организаторам здравоохранения, руководителям учреждений здравоохранения всех уровней – специалистам, которые принимают реальные решения, определяющие спектр лекарственных средств и объем их закупок.

In 2009, we switched to PCV10 and in 2011 we switched to PCV13. 2. <...> What is the schedule of PCV vaccination? <...> What were the main reasons for PCV introduction? <...> going for tender, PCV10 came in at a much lower cost than PCV7. <...> , we went for PCV13. 5.

Предпросмотр: Педиатрическая фармакология №1 2014.pdf (0,3 Мб)
23

ХРОНИКА СНГ [Электронный ресурс] / Вторичные металлы .— 2013 .— №5 (36) .— С. 10-11 .— Режим доступа: https://rucont.ru/efd/470389

Объем реализованных черных металлов и изделий из них на торгах Белорусской универсальной товарной биржи (БУТБ) в июле увеличился по отношению к июлю 2012 г. на 38% (в натуральном выражении), а по итогам января – июля по отношению к аналогичному периоду прошлого года – в 1,37 раза

В Германии гости увидели работу 2 пресса с прессующей крышкой модели PCV 2560 на площадке компании Кронимет

24

Пневмококковая инфекция в мире и Украине. Возможности ее профилактики [Электронный ресурс] / Голубовская // Клиническая инфектология и паразитология .— 2014 .— №1 .— С. 130-139 .— Режим доступа: https://rucont.ru/efd/492635

Автор: Голубовская

На сегодняшний день пневмококковая инфекция является весьма актуальной проблемой в связи с широкой распространенностью, тяжелыми клиническими формами, ростом резистентности пневмококка, что предопределяет достаточно высокую летальность от патологии. Это формирует потребность в профилактике пневмококковой инфекции, особенно у лиц, относящихся к группам риска тяжелого течения заболевания. По мнению ВОЗ, вакцинация – единственный способ существенно повлиять на заболеваемость пневмококковой инфекцией и, следовательно, снизить использование антибиотиков для ее лечения. 13-валентная полисахаридная конъюгированная адсорбированная вакцина (ПКВ 13) в настоящее время обеспечивает новый подход к профилактике пневмококковых заболеваний. Вакцинация ПКВ13 рекомендована взрослым лицам старше 50 лет, особенно с повышенным риском развития инвазивных пневмококковых заболеваний (лица в возрасте 65 лет и старше, лица с иммунодефицитными состояниями, хроническими сопутствующими заболеваниями)

PCV13 vaccination is recommended to adults after 50 y.o., especially with the high risks of invasive <...> Keywords: S.pneumoniae, pneumococcal infection, vaccination, PCV 13, PPV 23. ________________________

25

Болевой синдром после ринологических хирургических вмешательств под общей анестезией [Электронный ресурс] / Илюкевич, Гудный, Чурило // Экстренная медицина .— 2016 .— №2 .— С. 76-82 .— Режим доступа: https://rucont.ru/efd/473974

Автор: Илюкевич

С целью оптимизации анестезиологического пособия при ринологических операциях путем использования для обеспечения проходимости верхних дыхательных путей и уменьшения болевого синдрома ларингеальной маски было проведено ретроспективное рандомизированное исследование по изучению выраженности болевого синдрома после эндоназальных операций у 112 пациентов в возрасте от 18 до 67 лет (44 женщины, 68 мужчин; средний возраст – 37,02±13,46 года), выполненных под эндотрахеальной анестезией (ЭТА) (1-я группа, n=60) и ларингеальномасочной анестезией (ЛМА) (2-я группа, n=52). Показано, что болевой синдром в послеоперационном периоде при ринологических операциях является умеренно выраженным. Боль в горле, возникающая вследствие интубации трахеи, достоверно более выражена в первые два послеоперационных дня, чем при установке ларингеальной маски, что может приводить в дальнейшем к усилению негативного влияния болевого синдрома на общее состояние пациента. Ларингеальномасочная анестезия при ринологических операциях является более эффективным вариантом анестезиологического обеспечения с позиции повышения качества анестезиологического обеспечения и уменьшения выраженности болевого синдрома в послеоперационном периоде

Вентиляция легких выполнялась наркозно-дыхательным аппаратом ИВЛ Primus в режиме CMV (ЭТА) и в режиме PCV

26

№7 [Бюллетень экспериментальной биологии и медицины, 2020]

В журнале помещаются плановые работы научно-исследовательских учреждений в виде кратких оригинальных сообщений по актуальным вопросам биологии и медицины, содержащие новые существенные научные результаты. Главный редактор академик РАН В.П. Чехонин. Рубрики журнала “Бюллетень экспериментальной биологии и медицины”: - Физиология - Общая патология и патологическая физиология - Биофизика и биохимия - Фармакология и токсикология - Новые лекарственные препараты - Иммунология и микробиология - Аллергология - Генетика - Вирусология - Онкология - Экология - Нанотехнологии - Новые биомедицинские технологии - Экспериментальные методы - клинике - Биогеронтология - Приматология - Спортивная медицина - Экспериментальная биология - Морфология и патоморфология - Методики.

Для измерения диаметра задней кардинальной вены (posterior cardinal vein, PCV) эмбрионы каждого типа <...> В то время как у интактных эмбрионов спинная аорта (dorsal aorta, DA), PCV и ISVs уже были сформированы <...> Анализ чётко подтвердил наличие дефектов в сосудистых структурах, в частности дилатацию PCV. <...> по-видимому, вызывала у них улучшение развития сосудов, о чём свидетельствовало уменьшение диаметра PCV <...> MV — мезэнцефальная вена; PrA — прозэнцефальная артерия. г — изменения диаметра PCV (M±SD).

Предпросмотр: Бюллетень экспериментальной биологии и медицины №7 2020.pdf (0,6 Мб)
27

№1 [Российский онкологический журнал, 2012]

Основан в 1996 г. Главный редактор журнала - Лазарев Александр Федорович - доктор медицинский наук, профессор, директор Алтайского филиала ФГБУ «Российский онкологический научный центр им. Н.Н.Блохина» Минздрава России. В оригинальных и обзорных статьях журнал освещает современные научные достижения в области клинической и экспериментальной онкологии, практические проблемы диагностики, комбинированного и комплексного лечения злокачественных новообразований, вопросы научной организации противораковой борьбы, опыта работы практических онкологических учреждений. Публикует данные о внедрении научных достижений в практику и обмен опытом. Информирует о состоянии науки за рубежом, печатает статьи, обзоры, обобщающие научные данные по важнейшим теоретическим и практическим проблемам, истории онкологии, хронику.

или CCNU, которая применяется при глиомах достаточно редко, а с гораздо более распространенной схемой PCV <...> чем при одной ЛТ (11,2 мес; p = 0,002), но достоверно не отличалась от выживаемости леченых по схеме PCV <...> Тип адъювантной терапии (PCV или темозоломид) не имел значения ни для PFS, ни для OS, хотя токсичность <...> Brandes и соавт. [22] сравнивалась адъювантная ХТ темозоломидом с терапией PCV у пожилых больных с МГБ <...> до прогрессирования у получавших темозоломид (10,7 мес) была достоверно выше, чем у леченых по схеме PCV

Предпросмотр: Российский онкологический журнал №1 2012.pdf (0,8 Мб)
28

№7 [Радиотехника и электроника, 2017]

Публикуются статьи по широкому спектру теоретических и прикладных проблем радиоэлектроники, связи и физической электроники.Тематические рубрики журнала охватывают все важнейшие области радиотехники и электроники, такие как электродинамика, теория распространения радиоволн, обработка сигналов, линии передачи, теория и техника связи, физика полупроводников и физические процессы в электронных устройствах, применение методов радиоэлектроники и радиоэлектронных устройств в биологии и медицине, микроэлектроника, наноэлектроника, электронная и ионная эмиссия и т.д.

Были рассчитаны и измерены PCV антенны с излучателем с дополнительными щелями. <...> Рассчитанные PCV на частоте 1246 МГц составили не более 14 мм в диапазоне углов Θ = ± 85° и ϕ = ±180° <...> , где Θ = 0 – зенит ДН антенны (рис. 6а), измеренное наихудшее значение PCV в двух взаимно перпендикулярных <...> При этом характер поведения рассчитанных и измеренных PCV совпадает. <...> Подобное же поведение рассчитанных и измеренных PCV антенны отмечено и на частотах 1202, 1227, 1575.4

Предпросмотр: Радиотехника и электроника №7 2017.pdf (0,1 Мб)
29

CPAP-терапия как компонент периоперационного ведения пациентов с синдромом обструктивного апноэ во сне перед хирургическими вмешательствами на верхних дыхательных путях [Электронный ресурс] / Гудный, Илюкевич // Экстренная медицина .— 2017 .— №2 .— С. 45-55 .— Режим доступа: https://rucont.ru/efd/606493

Автор: Гудный

В работе изучено влияние CPAP-терапии на течение периоперационного периода у 61 пациента с синдромом обструктивного апноэ во сне. Включение ее в предоперационную подготовку пациентов перед хирургическими вмешательствами на верхних дыхательных путях обеспечило более благоприятное течение интраоперационного и ближайшего послеоперационного периодов. Авторами сделан вывод о необходимости проведения СРАР-терапии как обязательного компонента предоперационной подготовки пациентов с синдромом обструктивного апноэ во сне перед хирургическими вмешательствами на верхних дыхательных путях.

Механическая вентиляция легких выполнялась наркозно-дыхательными аппаратами в режиме CMV (ЭТА) и в режиме PCV

30

Методическая разработка для практических занятий и самостоятельной работы по учебной дисциплине «Физические основы электроники»

Изд-во ПГУТИ

Методическая разработка предназначена для организации самостоятельной работы и практических занятий студентов, обучающихся по направлениям подготовки бакалавров: 210700 - Инфокоммуникационные технологии и сети связи, 210400 - Радиотехника, 090900 - Информационная безопасность. Для организации практических аудиторных занятий методическая разработка включает в себя сборник типовых задач, часть из которых содержит несколько вариантов исходных данных. Это позволит сделать студентам определенные выводы и лучше подготовиться к итоговому тестированию. Кроме это- го, задания с несколькими вариантами могут быть использованы для проведения аудиторных контрольных работ на факультете заочного обучения. Краткие теоретические сведения включают в себя расчетные соотношения, необходимые для выполнения заданий. Для организации самостоятельной работы студентов методическая разработка содержит рекомендации по изучению дисциплины, список рекомендуемой литературы и список теоретических вопросов для подготовки к итоговому контролю.

отсчета принимается нижний уровень («дно») зоны проводимости) его энергия определяется выражением: n p n pcv <...> принимается верхний уровень «потолок» валентной зоны) энергия уровня Ферми определяется выражением: n p n pcv

Предпросмотр: Методическая разработка для практических занятий и самостоятельной работы по дисциплине «Физические основы электроники».pdf (0,3 Мб)
31

№4 [Вестник Российского университета дружбы народов. Серия: Медицина, 2015]

Основное содержание издания составляют научные статьи, обзоры и рецензии. В «Вестнике РУДН. Серия: Медицина» печатаются статьи по всем разделам медицины, здравоохранения и медицинского образования. Наименование и содержание рубрик издания соответствуют перечню научных специальностей, названию кафедр и сформировавшимся научным направлениям Медицинского института РУДН. Тематика статей в большой степени разнообразна. В них отражаются результаты научных работ при выполнении кандидатских и докторских диссертаций, а также других актуальных научных исследований, включая поисковые и отражающие совершенствование и расширение существующих диагностических и лечебных методов.

При лечении пациентов с ГНСЗ (первичная опухоль) используются несколько схем химиотерапии, а именно: PCV <...> существующим стандартам (СОД 54Гр, доза за фракцию 1,8Гр), а в качестве химиотерапии была использована схема PCV <...> Practice changing mature results of RTOG study 9802: another positive PCV trial makes adjuvant chemotherapy <...> Practice changing mature results of RTOG study 9802: another positive PCV trial makes adjuvant chemotherapy

Предпросмотр: Вестник Российского университета дружбы народов. Серия Медицина №4 2015.pdf (3,5 Мб)
32

СОВЕРШЕНСТВОВАНИЕ ПРОИЗВОДСТВЕННОЙ СТРУКТУРЫ МОЛОЧНОГО ПОДКОМПЛЕКСА ОБЛАСТНОГО АПК АВТОРЕФЕРАТ ДИС. ... КАНДИДАТА ЭКОНОМИЧЕСКИХ НАУК

Автор: КОШЕЛЕВ ВАЛЕРИЙ МИХАЙЛОВИЧ
М.: МОСКОВСКАЯ ОРДЕНА ЛЕНИНА И ОРДЕНА ТРУДОВОГО КРАСНОГО ЗНАМЕНИ СЕЛЬСКОХОЗЯЙСТВЕННАЯ АКАДЕМИЯ ИМЕНИ К. А. ТИМИРЯЗЕВА

Целью данного исследования является проведение системного анализа межотраслевых связей и пропорций, условий и факторов функционирования молочного подкомплекса областного АПК и на этой основе — разработка методических подходов к совершенствованию производственной структуры подкомплекса.

«ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис» роднохозяйственпых. оценок) каждой отрасли в конечные pcv

Предпросмотр: СОВЕРШЕНСТВОВАНИЕ ПРОИЗВОДСТВЕННОЙ СТРУКТУРЫ МОЛОЧНОГО ПОДКОМПЛЕКСА ОБЛАСТНОГО АПК.pdf (0,0 Мб)
33

МЕТОДИЧЕСКИЕ ПОДХОДЫ К ОЦЕНКЕ ПРИБЫЛИ ХОЗЯЙСТВУЮЩЕГО СУБЪЕКТА: ТЕОРЕТИЧЕСКИЙ АСПЕКТ [Электронный ресурс] / В.В. Мануйленко, Садовская // Финансовый бизнес .— 2013 .— №3 .— С. 51-59 .— Режим доступа: https://rucont.ru/efd/608534

Автор: Мануйленко Виктория Валерьевна

В статье изучаются методические подходы к оценке прибыли хозяйствующего субъекта с акцентом на акционерном обществе (АО), выявляются их достоинства, недостатки, целесообразность использования в современных условиях. В результате обосновывается необходимость формирования комплексного подхода к оценке прибыли

Рентабельность себестоимости PCV = P n / COGS, где P n – чистая прибыль; COGS – себестоимость реализованной

34

№3 [Педиатрическая фармакология, 2012]

В журнале «Педиатрическая фармакология» можно ознакомиться с клиническими рекомендациями, основанными на принципах доказательной медицины, и особенностями применения лекарственных и вакцинных средств у детей. Получить исчерпывающую информацию о воздействии лекарственных средств на плод, о проводимых в нашей стране фармако-экономических исследованиях, а также о наиболее нерешенной проблеме детской фармакологии – проведении клинических исследований, их правовых и этических аспектах. Кроме того, авторам, членам редакционного совета, ведущим рубрики, читателям предоставляется возможность принять участие в научной дискуссии на страницах журнала по опубликованным материалам, а также предложить свою тему для обсуждения, представив результаты собственного исследования, не согласующиеся с общепринятыми данными. Журнал предназначен практикующим педиатрам, детским врачам, специализирующимся в различных областях педиатрии, а также организаторам здравоохранения, руководителям учреждений здравоохранения всех уровней – специалистам, которые принимают реальные решения, определяющие спектр лекарственных средств и объем их закупок.

and PCV13, respectively [14]. <...> Effectiveness of PCV7 and PCV13 Over nearly a decade, PCV7 has demonstrated high efficacy against invasive <...> and not included in PCV7. <...> the PCV13 period, compared with 7 of 15 episodes during the PCV7 period. <...> The transition from PCV7 to PCV13 offered a unique opportunity to evaluate the impact of the PCV13 on

Предпросмотр: Педиатрическая фармакология №3 2012.pdf (0,3 Мб)
35

№1 [Клиническая физиология кровообращения, 2010]

Рецензируемый научно-практический журнал. Журнал представляет актуальные теоретические достижения по описанию, анализу и использованию процессов лечения и оценки болезней и нарушений кардио- и гемодинамики, кровообращения в легких, почках, головном мозге и других органах, а также их регуляцию и функцию. Основан в 2004 г. Журнал включен в Российский индекс научного цитирования. Входит в Перечень ВАК

легких (ИВЛ) Детская анестезиология традиционно отдавала предпочтение вентиляции по давлению (далее PCV <...> При PCV пиковое раздувание легких достигается раньше во время дыхательного цикла и таким образом легкое <...> На рисунке 3 представлены некоторые риски, связанные с вентиляцией легких в режиме PCV. <...> чтобы предотвратить гиповентиляцию или перераздувание легкого в ответ на изменение комплайнсов при PCV <...> Риски, связанные с вентиляцией легких в режиме PCV Особенности механики дыхания PCV, Pinsp = const При

Предпросмотр: Клиническая физиология кровообращения №1 2010.pdf (0,4 Мб)
36

Изучение точек разладки триплетной периодичности в нуклеотидных последовательностях генов [Электронный ресурс] / Суворова, Короткова, Коротков // Прикладная информатика / Journal of Applied Informatics .— 2012 .— №5 .— С. 75-88 .— Режим доступа: https://rucont.ru/efd/453150

Автор: Суворова

Задача разбиения неоднородной последовательности или временного ряда точками, разделяющими однородные участки, впервые возникла в контексте контроля качества на производстве и получила название задачи о разладке (change point problem). Она оказалась актуальной для самых различных областей, таких как контроль качества, оценка надежности, эконометрика и медицина, так как точки разладки отражают внутренние изменения исследуемых процессов

KKNQYFGPFPSAWAVRESIQILQRVFQLRTCEDSVFNNRTRPCLLHQIGRCSAPCV-GAI 570 K +YFGPFP+ +AVRE++ +LQ++F +R CE+SV+ NR+RPCL +QIGRC PCV

37

ДИАГНОСТИЧЕСКАЯ И ЛЕЧЕБНАЯ БРОНХОСКОПИИ У КАРДИОХИРУРГИЧЕСКИХ ПАЦИЕНТОВ, НАХОДЯЩИХСЯ НА ИСКУССТВЕННОЙ ВЕНТИЛЯЦИИ ЛЕГКИХ В ПОСЛЕОПЕРАЦИОННОМ ПЕРИОДЕ [Электронный ресурс] / Титова [и др.] // Анестезиология и реаниматология .— 2016 .— №1 .— С. 59-64 .— Режим доступа: https://rucont.ru/efd/379899

Автор: Титова

Обзор представляет анализ отечественной и зарубежной литературы, посвященной применению бронхоскопии у пациентов с обструктивной дыхательной недостаточностью в отделении реанимации. Отдельно рассмотрен вопрос о проведении дополнительных исследований при выполнении бронхоскопии и создании алгоритма применения диагностической и лечебной бронхоскопии у кардиохирургических пациентов, находящихся на ИВЛ.

end-expiratory pressure) — положительное давление конца выдоха (положительное конечно-экспираторное давление) PCV

38

ДИАГНОСТИКА И ИНТЕНСИВНАЯ ТЕРАПИЯ ОСТРОГО РЕСПИРАТОРНОГО ДИСТРЕСС-СИНДРОМА. КЛИНИЧЕСКИЕ РЕКОМЕНДАЦИИ ФАР [Электронный ресурс] / Грицан [и др.] // Анестезиология и реаниматология .— 2016 .— №1 .— С. 64-72 .— Режим доступа: https://rucont.ru/efd/379900

Автор: Грицан

Острый респираторный дистресс-синдром (ОРДС) является одним из основных осложнений различных жизнеугрожающих состояний. По последним данным The National Heart, Lung, and Blood Institute ARDS Clinical Trials Network, частота возникновения ОРДС достигает 79 на 100 000 населения в год. Летальность пациентов ОРДС составляет в среднем около 35—45 % в зависимости от причины ОРДС, тяжести его течения и полиорганной недостаточности [1—2].

end-expiratory pressure) — положительное давление конца выдоха (положительное конечно-экспираторное давление) PCV <...> управляемым объемом — SIMV, A/CMV etc) и или инспираторного давления (в режимах с управляемым давлением — PCV

39

ВЛИЯНИЕ РАЗЛИЧНЫХ ВИДОВ ПОЛИМИКРОУДОБРЕНИЙ НА ДИНАМИКУ НАКОПЛЕНИЯ ВАЖНЕЙШИХ ЗОЛЬНЫХ ЭЛЕМЕНТОВ, АЗОТИСТЫХ ВЕЩЕСТВ И УГЛЕВОДНЫЙ ОБМЕН В РАСТЕНИЯХ АВТОРЕФЕРАТ ДИС. ... КАНДИДАТА СЕЛЬСКОХОЗЯЙСТВЕННЫХ НАУК

Автор: МАМЕДОВА
АКАДЕМИЯ НАУК АЗЕРБАЙДЖАНСКОЙ ССР ОТДЕЛЕНИЕ БИОЛОГИЧЕСКИХ НАУК

Перед нами стояла задача изучить действие четырёх по полимикроудобрений, имеющих в своем составе различное соотношение большого количества микроэлементов, на ведущие культуры в различных зонах Азербайджана — хлопчатник и кукурузу

. ^ •^o •• • • A4 r £ 1 * \ Г" , * i • eg о ft;1 PcV ' / Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство

Предпросмотр: ВЛИЯНИЕ РАЗЛИЧНЫХ ВИДОВ ПОЛИМИКРОУДОБРЕНИЙ НА ДИНАМИКУ НАКОПЛЕНИЯ ВАЖНЕЙШИХ ЗОЛЬНЫХ ЭЛЕМЕНТОВ, АЗОТИСТЫХ ВЕЩЕСТВ И УГЛЕВОДНЫЙ ОБМЕН В РАСТЕНИЯХ.pdf (0,0 Мб)
40

Общая вирусология с основами таксономии вирусов позвоночных учеб. пособие

ГОУ ОГУ

Учебник представляет собой систематизированное изложение общей вирусологии, методов диагностики вирусных инфекций и таксономии вирусов позвоночных, что соответствует пунктам профессиональной компетентности ПК-1 (демонстрирует базовые представления о разнообразии биологических объектов, понимание значения биоразнообразия для устойчивости биосферы) и ПК-2 (использует методы наблюдения, описания, идентификации, классификации, культивирования биологических объектов) федерального образовательного стандарта высшего профессионального образования по направлению подготовки 020400 – Биология (степень – «Бакалавр», «Магистр»). В учебнике представлены общие сведения о истории вирусологии, химическом составе генетике репродукции вирусов, выделении и очистки вирусных препаратов, методах диагностики вирусных инфекций, таксономии вирусов позвоночных.

CAV и PCV устойчивы при рН 3 и инкубировании при 70 °С в течение 15 минут. <...> Размер генома CAV и PCV составляет 2298 kbp и 1759 kbp, соответственно. <...> Неструктурные протеины PCV неохарактеризованы. <...> Сайт начала репликации ДНК PCV картирован. <...> Для CAV, PCV и BFDV общих антигенов не найдено.

Предпросмотр: Общая вирусология с основами таксономии вирусов позвоночных.pdf (0,7 Мб)
41

№8-9 [Ремедиум. Журнал о российском рынке лекарств и медтехники, 2009]

Журнал о российском рынке лекарств и медицинской технике - информационно-аналитическое издание для профессионалов, работающих на российском фармацевтическом рынке.

в РФ под торговым наименованием Превенар, производится компанией Wyeth) и PCV10. <...> В результате введения универсальной вакцинации пневмококковой конъюгированной PCV 7 (Превенар) и принятия <...> предотвращенных за счет прямых и косвенных эффектов от введения пневмококковой конъюгированной вакцины (PCV <...> По результатам проведенных оценок PCV 7 имеет проверенный профиль безопасности и эффективна против ИПИ <...> C 2009 г. в России зарегистрирована пневмококковая конъюгированная 7-валентная вакцина PCV 7 (Превенар

Предпросмотр: РЕМЕДИУМ №8-9 2009.pdf (0,2 Мб)
42

№6 [Педиатрическая фармакология, 2012]

В журнале «Педиатрическая фармакология» можно ознакомиться с клиническими рекомендациями, основанными на принципах доказательной медицины, и особенностями применения лекарственных и вакцинных средств у детей. Получить исчерпывающую информацию о воздействии лекарственных средств на плод, о проводимых в нашей стране фармако-экономических исследованиях, а также о наиболее нерешенной проблеме детской фармакологии – проведении клинических исследований, их правовых и этических аспектах. Кроме того, авторам, членам редакционного совета, ведущим рубрики, читателям предоставляется возможность принять участие в научной дискуссии на страницах журнала по опубликованным материалам, а также предложить свою тему для обсуждения, представив результаты собственного исследования, не согласующиеся с общепринятыми данными. Журнал предназначен практикующим педиатрам, детским врачам, специализирующимся в различных областях педиатрии, а также организаторам здравоохранения, руководителям учреждений здравоохранения всех уровней – специалистам, которые принимают реальные решения, определяющие спектр лекарственных средств и объем их закупок.

Again, it was not until the widespread deployment of pneumococcal conjugate vaccine (PCV) that the full <...> The original 7-valent PCV is being replaced by 10-nd 13-valent versions, and the further benefits of <...> PCV are now starting to be enjoyed [16]. <...> The added benefit of herd protection has been observed with Hib vaccines [23, 24], with PCV vaccines <...> доступными дополнительные преимущества PCV [16].

Предпросмотр: Педиатрическая фармакология №6 2012.pdf (0,3 Мб)
43

№4 [Вопросы современной педиатрии, 2011]

В журнале «Вопросы современной педиатрии» освещаются самые актуальные вопросы научного и прикладного характера, в том числе социальная педиатрия, клиника и диагностика детских болезней, вопросы профилактики и реабилитации, питания здорового и больного ребенка. В журнале публикуются статьи ведущих российских специалистов - детских врачей, детских гигиенистов, специалистов по восстановительной медицине, организаторов здравоохранения, лекции по фундаментальной медицине. Каждый номер журнала отражает современное состояние педиатрической науки в России. На страницах журнала можно ознакомиться с официальной информацией (распоряжения, объявления, новости и т.д.) Союза педиатров России и материалами, одобренными этой профессиональной организацией.

СПИСОК ЛИТЕРАТУРЫ Группа риска Тип вакцины Возраст от 2 мес до 5 лет PCV Дети любого возраста из закрытых <...> детских учреждений PCV — до 5 лет или PPSV23 — после 2 лет Дети с ВПС, БЛД, СКА, ФА, муковисцидозом, <...> — до 5 лет или PPSV23 — после 2 лет Дети с транзиторной младенческой гипогаммаглобулинемией PCV — под <...> контролем выработки поствакцинальных антител* Дети с ПИД за исключением гуморальных ИДС PCV — до 5 лет <...> 2 лет, под контролем выработки поствакцинальных антител* Дети с ВИЧ с виремией < 100 тыс. копий/мл PCV

Предпросмотр: Вопросы современной педиатрии №4 2011.pdf (0,3 Мб)
44

№3 [Вопросы гематологии/онкологии и иммунопатологии в педиатрии, 2009]

Научно-практический журнал Международной организации Consensus in Pediatrics. Журнал выпускается с 2002 г. и предназначен для детских онкологов и гематологов, педиатров, научных работников. Журнал входит в Международную реферативную базу Scopus и в Перечень ведущих научных журналов и изданий ВАК, в которых должны быть опубликованы основные результаты диссертаций на соискание ученой степени кандидата и доктора наук. Журнал зарегистрирован в Ulrich's International Periodical Directory, РИНЦ. Журнал публикует оригинальные исследования, обзоры литературы, лекции, методические рекомендации, клинические наблюдения, официальные документы органов управления здравоохранением. Тематика публикаций: - диагностика, особенности течения, лекарственная терапия опухолевых заболеваний, болезней крови, иммунодефицитных и иммунопатологических состояний в детском возрасте; - большое внимание уделяется вопросам фармакотерапии с применением химиотерапевтических средств, рекомбинантных интерферонов, интерлейкинов и колониестимулирующих факторов, моноклональных противоопухолевых препаратов, иммуноглобулинов и факторов свертывания крови.

Оценку накопления 3H-FEAU и 3H-PCV выполняли согласно описанной ранее методике [19]. <...> Интенсивность накопления (Ki) для 3H-FEAU и 3H-PCV определяли путем построения кривой отношения (dpm/ <...> Накопление 3H-PCV было обнаружено во всех трансдуцированных клетках, однако интенсивность накопления <...> Установлено, что интенсивность накопления 3H-PCV в нетрансдуцированных U87 клетках равна фоновой (Ki: <...> геном R176Qtk, накапливают минимальные количества FEAU, но не накапливают PCV.

Предпросмотр: Вопросы гематологиионкологии и иммунопатологии в педиатрии №3 2009.pdf (0,1 Мб)
45

№3 [Вопросы нормативно-правового регулирования в ветеринарии, 2010]

В журнале публикуются статьи, посвященные правовым вопросам в сфере ветеринарной медицины, сельского хозяйства и агропромышленного комплекса.

секундарная микрофлора, фибрин, ЦВС-2 (Keywords: necrotic vasculit, RRSP, secondary microflora, thrombin, PCV <...> contains the results of study of the pathomorfological changes in sick pigs' parenchymatous organs with PCV <...> гемофилезный полисерозит, ЦВС-2, экономическая эффективность (Key words: serum, haemophilus poliserozity, PCV

Предпросмотр: Вопросы нормативно-правового регулирования в ветеринарии №3 2010.pdf (3,1 Мб)
46

№2 [Анестезиология и реаниматология, 2012]

Основан в 1956 г. (под названием "Экспериментальная хирургия и анестезиология", с 1977 г. - "Анестезиология и реаниматология"). Главный редактор журнала - Бунятян Армен Артаваздович - академик РАМН, профессор, руководитель отдела анестезиологии и реанимации ФГБУ Российский научный центр хирургии им. академика Б.В. Петровского РАМН, заведующий кафедрой анестезиологии и реаниматологии ФППОВ ГБОУ ВПО Первый Московский государственный медицинский университет им. И.М. Сеченова. журнал клинического направления. Основное внимание журнал уделяет проблемам общей анестезии в хирургии, интенсивной терапии и реанимации. Значительное место на страницах журнала занимает пропаганда передовых методов анестезиологии и реаниматологии в акушерстве, гинекологии и педиатрии (включая микропедиатрию), в стоматологии, оториноларингологии, в амбулаторной практике и многое другое.>Систематически освещаются вопросы интенсивной терапии и реанимации (вне связи с хирургией при травмах, отравлениях, инфекционных заболеваниях).Журнал печатает обзоры и лекции по актуальным проблемам анестезиологии и реаниматологии, дискуссионные статьи, (знакомит читателей с методикой и практикой преподавания общей анестезиологии, интенсивного лечения и реанимации). Освещаются смежные вопросы физиологии, фармакологии и гематологии. Журнал широко освещает вопросы применения новой анестезиологической аппаратуры, средств мониторного наблюдения и экспресс-диагностики, знакомит с новыми препаратами для наркоза. Публикует протоколы заседаний обществ анестезиологов и реаниматологов Москвы, отчеты о всемирных конгрессах, съездах и пленумах правления Научного общества анестезиологов и реаниматологов, информационные материалы и рецензии на различные публикации. Для практических анестезиологов и реаниматологов введен специальный раздел, посвященный редким или поучительным практическим наблюдениям, ошибкам и осложнениям с их разбором и комментариями ведущих специалистов.

тяжелым повреждением легких (атипичная пневмония, ОПЛ, ОРДС) и малоэффективной вентиляцией в режиме PCV <...> Применялись следующие параметры вентиляции: частота f(PCV) = 24 ± 4 в мин, частота PEEPh f(Peeph) = 6 <...> теоретической математической симуляции 3LV в математической и физической модели. 3LV в сравнении с PCV <...> определили как способ ИВЛ, при которой основной уровень вентиляции создают вентиляционные режимы CMV, PCV <...> Режим ИВЛ (SIMV-PS, BIPAP, SIMV, CMV, IPPV, CPAP-PS, PCV, СРАР, А/С, A/CMV, ASV, BiLevel, ВЧ осцилляторная

Предпросмотр: Анестезиология и реаниматология №2 2012.pdf (3,8 Мб)
47

№2 [Педиатрическая фармакология, 2014]

В журнале «Педиатрическая фармакология» можно ознакомиться с клиническими рекомендациями, основанными на принципах доказательной медицины, и особенностями применения лекарственных и вакцинных средств у детей. Получить исчерпывающую информацию о воздействии лекарственных средств на плод, о проводимых в нашей стране фармако-экономических исследованиях, а также о наиболее нерешенной проблеме детской фармакологии – проведении клинических исследований, их правовых и этических аспектах. Кроме того, авторам, членам редакционного совета, ведущим рубрики, читателям предоставляется возможность принять участие в научной дискуссии на страницах журнала по опубликованным материалам, а также предложить свою тему для обсуждения, представив результаты собственного исследования, не согласующиеся с общепринятыми данными. Журнал предназначен практикующим педиатрам, детским врачам, специализирующимся в различных областях педиатрии, а также организаторам здравоохранения, руководителям учреждений здравоохранения всех уровней – специалистам, которые принимают реальные решения, определяющие спектр лекарственных средств и объем их закупок.

Accepted: 24.01.2014, submitted for publication: 24.02.2014 — When Pneumococcal conjugated vaccine (PCV <...> On average, max 2 shots/visit was dont (DaPT-IPV-Hib + PCV). — What were the main reasons for PCV introduction <...> — Pediatricians in general practice expressed their opinion at several forums, because the PCV7 vaccine <...> passive, lab based surveillance has also been introduced along with the immunisation program. — What PCV <...> At first, in 2008 and 2009 only PCV7 was available.

Предпросмотр: Педиатрическая фармакология №2 2014.pdf (0,3 Мб)
48

№3 [Ветеринарный Фармакологический Вестник, 2019]

PCV-2, listeriae, leptospirae, campylobacters were not isolated from boar semen during the experiment <...> 2 / 4.4 9 Campylobacters 0.0 0.0 0.0 0.0 During the analyzed period, the associations of PRRS, PPV, PCV <...> in 335 (46.6 %) cases, including in association with PRRS virus — in 8 (2.3 %), PPV — in 5 (1.4 %), PCV <...> The number of positive samples /% 2016y n = 198 2017y n = 202 2018г n = 194 Total number n = 594 1 PCV <...> of 8 pathogens (pathogenic mycoplasmas, chlamydiae, salmonellae, listeriae, leptospirae, PRRS, PPV, PCV

Предпросмотр: Ветеринарный Фармакологический Вестник №3 2019.pdf (1,1 Мб)
49

№1 [Педиатрическая фармакология, 2018]

В журнале «Педиатрическая фармакология» можно ознакомиться с клиническими рекомендациями, основанными на принципах доказательной медицины, и особенностями применения лекарственных и вакцинных средств у детей. Получить исчерпывающую информацию о воздействии лекарственных средств на плод, о проводимых в нашей стране фармако-экономических исследованиях, а также о наиболее нерешенной проблеме детской фармакологии – проведении клинических исследований, их правовых и этических аспектах. Кроме того, авторам, членам редакционного совета, ведущим рубрики, читателям предоставляется возможность принять участие в научной дискуссии на страницах журнала по опубликованным материалам, а также предложить свою тему для обсуждения, представив результаты собственного исследования, не согласующиеся с общепринятыми данными. Журнал предназначен практикующим педиатрам, детским врачам, специализирующимся в различных областях педиатрии, а также организаторам здравоохранения, руководителям учреждений здравоохранения всех уровней – специалистам, которые принимают реальные решения, определяющие спектр лекарственных средств и объем их закупок.

Key features and differences of PCV10 and PCV13 [41, 42] Параметры ПКВ10 ПКВ13 Серотипы / Количество <...> Introduction of PCV7 in the routine immunization schedule in 2007; introduction of PCV13 in 2011. flat <...> strains within the universal immunization program PCV7 / PCV13 (2009–2014) [23]. <...> _ SAGE_PCV_WG_Oct2017.pdf. 5. <...> Implementation of PCV7/ PCV13 in Israel had a signifi cant impact on both pneumococcal and non-pneumococcal

Предпросмотр: Педиатрическая фармакология №1 2018.pdf (0,5 Мб)
50

№3 [Вопросы современной педиатрии, 2019]

В журнале «Вопросы современной педиатрии» освещаются самые актуальные вопросы научного и прикладного характера, в том числе социальная педиатрия, клиника и диагностика детских болезней, вопросы профилактики и реабилитации, питания здорового и больного ребенка. В журнале публикуются статьи ведущих российских специалистов - детских врачей, детских гигиенистов, специалистов по восстановительной медицине, организаторов здравоохранения, лекции по фундаментальной медицине. Каждый номер журнала отражает современное состояние педиатрической науки в России. На страницах журнала можно ознакомиться с официальной информацией (распоряжения, объявления, новости и т.д.) Союза педиатров России и материалами, одобренными этой профессиональной организацией.

The experience of immunization with 13-valent pneumococcal conjugate vaccine (PCV13) and haemophilus <...> The efficiency and safety of immunization with PCV13 and haemophilus influenzae-tetanus toxoid conjugate <...> Vaccination of infants with 13-valent pneumococcal conjugate vaccine (PCV) was implemented in national <...> Effectiveness of pneumococcal conjugate vaccines (PCV7 and PCV13) against invasive pneumococcal disease <...> _ SAGE_PCV_ WG_Oct2017.pdf. 8.

Предпросмотр: Вопросы современной педиатрии №3 2019.pdf (0,5 Мб)
Страницы: 1 2 3 ... 7